PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g021974m
Common NameCISIN_1g021974mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 305aa    MW: 33798.4 Da    PI: 7.611
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g021974mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1291.4e-403596263
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                       +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  orange1.1g021974m 35 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 96
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.6E-343793IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-243988IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6463993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MDASSGQHQE MATHSLESML VCSKAQQERK PRPQPEQALK CPRCDSTNTK FCYYNNYSLS  60
QPRYFCKSCR RYWTKGGTLR NVPVGGGCRK NKRSSSSSSK RSQDQPLMSS NTSPLTNFPP  120
LSYDTNDLSL AFARLQKQNG GQLGFDDQHD FSILGNPVSS HCDILGNPSI SSSTSATTTP  180
AFLDALRSGF LDTHNNFQNL YYGFGNANSM GEVDHHHHHH LNHNHDHGAS AEMLMPFGDH  240
QMSATNATTT AVTVTTMKQE LCNSRESENS KVLWGFPWQL NNADASMNNE LNSTWHGLLN  300
SPLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.100350.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488187.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLA0A067G3Z40.0A0A067G3Z4_CITSI; Uncharacterized protein
STRINGGLYMA12G07710.11e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-36TARGET OF MONOPTEROS 6